Fast Worldwide Shipping With Tracked 48 hour DHL Express Delivery

LL-37 5mg
(Cathelicidin)

(Heptatriacontapeptide–37 Amino Acids)

( Product no. 871-10 )

£31.99

Advanced Antimicrobial Class Peptide

LL-37 is a cationic, amphipathic peptide derived from the human cathelicidin antimicrobial protein hCAP-18. It is the only cathelicidin identified in humans and is composed of 37 amino acids. LL-37 adopts an alpha-helical structure and is studied extensively in immunology, Valued for its consistency and versatility, LL‑37 remains a respected choice for laboratories exploring peptide interactions, microbial environments, and advanced cellular pathways.

  Buy now
We offer:
We offer payment cards

LL-37 10mg
(Cathelicidin)

Premium Grade | UK Supply

Product Overview

LL37 is a cationic host defence peptide examined extensively in laboratory research for its role in innate immune signalling membrane interaction dynamics and cellular communication processes. It is derived from the C terminal region of the human cathelicidin antimicrobial protein and is studied for its ability to interact with lipid membranes nucleic acids and intracellular signalling systems. Due to its amphipathic structure and well defined molecular behaviour LL37 serves as a key research tool for investigating peptide mediated immune signalling barrier function and cellular response coordination within controlled experimental models.

 

Scientific Background

From a molecular science perspective LL37 is characterised by its alpha helical structure and positive charge distribution which facilitate interaction with negatively charged membrane components. Research focuses on how LL37 associates with phospholipid bilayers modulates membrane permeability and influences intracellular signalling cascades following membrane engagement. LL37 is also studied for its interaction with nucleic acid complexes and pattern recognition receptor pathways which contribute to immune signal modulation and transcriptional response regulation. These properties allow researchers to examine peptide driven signalling integration membrane associated communication and innate immune pathway coordination at the cellular level.

 

Research Applications

LL37 is utilised in laboratory research across immunology molecular biology peptide chemistry and cellular signalling disciplines. Researchers apply LL37 to study membrane peptide interactions immune signalling pathway activation and intracellular response mechanisms under controlled laboratory conditions. Additional applications include investigation of epithelial barrier models nucleic acid peptide complex formation and signalling crosstalk between innate immune receptors. These research models support deeper understanding of host defence peptide behaviour and immune system signalling organisation.

 

Technical Specifications

  • Contents: 10mg LL-37
  • Form: Lyophilized powder
  • Purity: >99% (HPLC Verified)
  • Storage: Store between 2°C and 8°C
  • Molecular Formula: C₂₁₅H₃₄₄N₆₀O₅₀
  • Sequence: [LL-37, 37 aa]
  • Peptide Length: 37 Amino-Acids 
  • pH Range: 5.5-7.4
  • Storage: Store between 2°C and 8°C

Note: Reconstitute with Bacteriostatic (BAC) water for best results.

 

Related Research Compounds

Mot-c 10mg
ACE-31 1mg
GHK-cu 100mg

 

Internal Research Sources

Trade supply
Peptides sets
Bulk urchase range

 

Disclaimer

For research purpose only, Not for human consumption.

£78.99
£28.99
£29.99
£32.99
£39.99

How to Reconstitute Your Peptides

 

What You Will Need 

  • Lyophilized peptide vial
  • Sterile solvent (such as bacteriostatic water or another suitable choice)
  • 1 ml sterile syringe with a fine (29–30g) needle
  • Sterile alcohol wipes
  • Calculator for dilution and dosage accuracy
  • Labels for marking each aliquot with concentration and date
  • Sterile workspace or biosafety cabinet (recommended for best practice)

 

Preparation Steps

Allow the vial to reach room temperature

This helps prevent condensation, which can compromise sterility when you open the vial.

Draw up the solvent

Using a sterile syringe, measure the precise amount of bacteriostatic water or your chosen solvent.

Inject the solvent gently

Insert the needle into the vial at a 45-degree angle so the liquid runs down the inside wall, which reduces bubbling and foam.

Dissolve the peptide

Swirl the vial gently until the peptide powder is completely dissolved. Avoid shaking, as this can damage the peptide bonds.

Aliquot the solution

If smaller, single-use portions are needed, divide the solution into sterile microtubes using a new, sterile syringe or pipette for each.


 

Learn More

 

 

Tips for Storing Your Peptides

 


General Storage Guidelines

  • Store all peptides in airtight, moisture-resistant containers to prevent exposure to humidity.
  • Minimise freeze-thaw cycles by dividing peptides into single-use aliquots whenever possible.
  • Protect peptides from light, especially if they are modified or known to be photosensitive, by storing them in amber vials or wrapping them in foil.
  • Always practice sterile handling and accurate labelling, including peptide name, concentration, date, and storage conditions.

Lyophilised Peptides

  • Keep lyophilised (freeze-dried) peptides at minus 20°C or lower for long-term stability.
  • Ensure the container is sealed tightly to keep out moisture.
  • Allow the vial to reach room temperature before opening to avoid condensation, which can degrade the peptide.
  • Only open vials in a dry environment to prevent humidity from affecting the product.

Reconstituted Peptides

  • Store peptides reconstituted with sterile water or buffer at 2°C to 8°C and use within 1–12 weeks.
  • If peptides are dissolved in DMSO or other organic solvents, store them at minus 20°C and protect from light.
  • Always aliquot into single-use volumes immediately after reconstitution to avoid repeated freeze-thaw cycles.
  • Clearly label all aliquots with relevant information and only thaw as needed to preserve the peptide’s activity and integrity.

Read More on Storage Guidelines

 

 

Shipping and Postage

 

UK & European Delivery

Evri UK Tracked 1-2 Business Days 

This costs; £4.99 per order

European DHL Express Tracked 1-2 Days 

This cost; £24.99 per order

Bioplex Peptides offers fast and reliable 1-2 days delivery across the UK with full tracking included. Note; Due to the nature of our products, we only dispatch samples between Monday-Thursday, orders after 12pm will be shipped the following day. 

*We aim to dispatch and deliver orders within the stated timeframes, but delays can occur due to severe weather, transport issues, public holidays, or other unforeseen events. Once an order has been dispatched, extended delivery times are outside our control.

Tax & Duty Information

Shipping Policy

International Delivery

United States of America & Canada 1-2 Business Days

This cost; £24.99 per order
 

International Delivery 1-3 Business Days

This cost; £29.99 per order

Bioplex Peptides offers fast and reliable 1-3 days worldwide delivery with full tracking included using the worlds fastest and most reliable courier available with a discounted rate for all EU & International customers. Delays may occur due to natural causes such as severe weather conditions, transportation disruptions, public holidays, or other unforeseen events. All international samples ship Monday–Saturday, ensuring steady worldwide delivery scheduling.

Tax & Duty Information

Shipping Policy

Order Processing

Orders are typically processed within 24hrs after payment confirmation. Custom peptide synthesis orders and wholesale orders may require additional lead time depending on complexity and quantity. Clients will be notified of estimated delivery timelines upon order confirmation.

Shipping Methods and Carriers

We utilize reliable courier services such DHL Express Premium 1-2 Business days for all International deliveries and Evri & Royal Mail tracked 1-2 days delivery for all United Kingdom deliveries to ensure timely and traceable delivery. Shipping options may vary depending on destination, order size, and regulatory requirements.

BioPleX Peptides is not responsible for delays caused by customs clearance, weather disruptions, or carrier-related issues.

Returns and Refunds

Due to the specialised and perishable nature of our research peptide products, BioPlex Peptides does not offer general refunds or accept returns once an order has been shipped. All purchases are considered final unless they meet specific criteria outlined below.

Refunds and Replacements

We do not provide refunds for products that have been correctly fulfilled and delivered. However, if an item arrives damaged, compromised, or incorrect due to an error on our part, we will offer a replacement at no additional cost. Claims must be submitted within 48 hours of delivery, accompanied by photographic evidence and a description of the issue.

Missing Parcels

If your parcel has not arrived within the estimated delivery window, please contact our logistics team promptly. We will initiate an investigation with the carrier and provide updates throughout the process. If the parcel is confirmed lost, we will issue a replacement shipment or credit, depending on the circumstances.

Order Cancellation

Orders may be cancelled within 24 hours of placement, provided production has not yet begun. Custom peptide synthesis orders are non-cancellable once processing has started. To request a cancellation, please email us at enquiries@bioplexpeptides.co.uk with your order number and reason for cancellation.

Damaged or Incorrect Items

In the rare event that you receive a damaged or incorrect item, please notify us within 48 hours of receipt. Include your order number, photos of the product and packaging, and a description of the issue. We will assess the claim and, if validated, arrange for a replacement to be shipped promptly.

 

Read More on Our Returns & Refunds Policy

 

0
Shopping Basket
X