Now shipping to the USA and Canada with tracked 48hr delivery via DHL Express!

LL-37 5mg
(Cathelicidin)

£43.99

"Advanced Antimicrobial Class Peptide"

LL-37 is a cationic, amphipathic peptide derived from the human cathelicidin antimicrobial protein hCAP-18. It is the only cathelicidin identified in humans and is composed of 37 amino acids. LL-37 adopts an alpha-helical structure and is studied extensively in immunology, Valued for its consistency and versatility, LL‑37 remains a respected choice for laboratories exploring peptide interactions, microbial environments, and advanced cellular pathways. molecular biology

  Buy now
We offer:
We offer payment cards

High-purity LL-37 peptide supplied in a 3ml sterile lyophilized vial

Specifications:

  • Contents: 10mg LL-37
  • Form: Lyophilized powder
  • Purity: >99% (HPLC Verified)
  • Storage: Store between 2°C and 8°C
  • Molecular Formula: C₂₁₅H₃₄₄N₆₀O₅₀
  • Sequence: [LL-37, 37 aa]
  • Peptide Length: 37 Amino-Acids 
  • pH Range: 5.5-7.4
  • Storage: Store between 2°C and 8°C

Note: Reconstitute with Bacteriostatic (BAC) water before use

LL-37 Peptide – Premium Grade (UK Supply)
Our LL-37 peptide is offered in the UK with verified purity exceeding 99%, manufactured under stringent conditions in ISO 9001 and GMP-certified laboratories. Intended exclusively for in-vitro research, this compound adheres to rigorous analytical and production standards to ensure consistency and reliability across experimental protocols

Supplied as a lyophilized powder, LL-37 maintains optimal molecular stability, facilitating precise handling and long-term preservation. To safeguard against degradation, oxidation, or contamination, researchers are advised to follow our comprehensive reconstitution and storage guidelines, available on our website

Each batch is synthesized through a controlled, high-fidelity process, ensuring structural integrity and reproducibility for scientific applications. Vials are prepared for reconstitution as required, supporting flexible use in laboratory settings
*For research purposes only, not for human consumption

 

(0.15)MB
Certificate of Analysis for-LL-37 Peptide
£78.99
£25.99
£32.99
£29.99
£43.99

How to Reconstitute Your Peptides

 

What You Will Need 

  • Lyophilized peptide vial
  • Sterile solvent (such as bacteriostatic water or another suitable choice)
  • 1 ml sterile syringe with a fine (29–30g) needle
  • Sterile alcohol wipes
  • Calculator for dilution and dosage accuracy
  • Labels for marking each aliquot with concentration and date
  • Sterile workspace or biosafety cabinet (recommended for best practice)

 

Preparation Steps

Allow the vial to reach room temperature

This helps prevent condensation, which can compromise sterility when you open the vial.

Draw up the solvent

Using a sterile syringe, measure the precise amount of bacteriostatic water or your chosen solvent.

Inject the solvent gently

Insert the needle into the vial at a 45-degree angle so the liquid runs down the inside wall, which reduces bubbling and foam.

Dissolve the peptide

Swirl the vial gently until the peptide powder is completely dissolved. Avoid shaking, as this can damage the peptide bonds.

Aliquot the solution

If smaller, single-use portions are needed, divide the solution into sterile microtubes using a new, sterile syringe or pipette for each.


 

Learn More

 

 

Tips for Storing Your Peptides

 


General Storage Guidelines

  • Store all peptides in airtight, moisture-resistant containers to prevent exposure to humidity.
  • Minimise freeze-thaw cycles by dividing peptides into single-use aliquots whenever possible.
  • Protect peptides from light, especially if they are modified or known to be photosensitive, by storing them in amber vials or wrapping them in foil.
  • Always practice sterile handling and accurate labelling, including peptide name, concentration, date, and storage conditions.

Lyophilised Peptides

  • Keep lyophilised (freeze-dried) peptides at minus 20°C or lower for long-term stability.
  • Ensure the container is sealed tightly to keep out moisture.
  • Allow the vial to reach room temperature before opening to avoid condensation, which can degrade the peptide.
  • Only open vials in a dry environment to prevent humidity from affecting the product.

Reconstituted Peptides

  • Store peptides reconstituted with sterile water or buffer at 2°C to 8°C and use within 1–12 weeks.
  • If peptides are dissolved in DMSO or other organic solvents, store them at minus 20°C and protect from light.
  • Always aliquot into single-use volumes immediately after reconstitution to avoid repeated freeze-thaw cycles.
  • Clearly label all aliquots with relevant information and only thaw as needed to preserve the peptide’s activity and integrity.

Read More on Storage Guidelines

 

 

Shipping and Postage

 

UK Delivery

Evri Tracked 1-2 Business Days 

This costs; £4.99 per order

Free Worldwide Shipping on all
our "Bulk Purchase Range"

Bioplex Peptides offers fast and reliable 1-2 days delivery across the UK with full tracking included. Note; Due to the nature of our products, we only ship samples between Monday-Thursday, all orders after 12pm daily, Monday-Wednesday will be shipped the following day. 

*While we always aim to dispatch and deliver orders within the stated timeframes, please note that delivery times may occasionally be affected by circumstances beyond our control. Delays may occur due to natural causes such as severe weather conditions, transportation disruptions, public holidays, or other unforeseen events. In such cases, delivery times may be extended, and we cannot be held responsible for delays once an order has been dispatched. We appreciate your understanding and patience, and we will always do our best to support you with tracking updates where available*

Shipping Policy

European & International Delivery

DHL Express Tracked 1-2  Business Days

European Delivery

This cost; £19.99 per order

United States of America Delivery

This Cost; £19.99 per order

International Delivery

This cost; £24.99 per order

Free Worldwide shipping on all
our "Bulk Purchase Range"

Bioplex Peptides offers fast and reliable 1-3 days worldwide delivery with full tracking included using the worlds fastest and most reliable courier available with a discounted rate for all Eu & International customers.  Note; Due to the nature of our products, we only ship samples between Monday-Thursday, all orders after 12pm daily, Monday-Wednesday will be shipped the following day. 

Shipping Policy

Order Processing

Orders are typically processed within 24hrs after payment confirmation. Custom peptide synthesis orders and wholesale orders may require additional lead time depending on complexity and quantity. Clients will be notified of estimated delivery timelines upon order confirmation.

Shipping Methods and Carriers

We utilize reliable courier services such DHL Express Premium 1-3 business days for all International deliveries and Evri & Royal Mail tracked 1-2 days delivery for all United Kingdom deliveries to ensure timely and traceable delivery. Shipping options may vary depending on destination, order size, and regulatory requirements.

BioPleX Peptides is not responsible for delays caused by customs clearance, weather disruptions, or carrier-related issues.

Returns and Refunds

Due to the specialised and perishable nature of our research peptide products, BioPlex Peptides does not offer general refunds or accept returns once an order has been shipped. All purchases are considered final unless they meet specific criteria outlined below.

Refunds and Replacements

We do not provide refunds for products that have been correctly fulfilled and delivered. However, if an item arrives damaged, compromised, or incorrect due to an error on our part, we will offer a replacement at no additional cost. Claims must be submitted within 48 hours of delivery, accompanied by photographic evidence and a description of the issue.

Missing Parcels

If your parcel has not arrived within the estimated delivery window, please contact our logistics team promptly. We will initiate an investigation with the carrier and provide updates throughout the process. If the parcel is confirmed lost, we will issue a replacement shipment or credit, depending on the circumstances.

Order Cancellation

Orders may be cancelled within 24 hours of placement, provided production has not yet begun. Custom peptide synthesis orders are non-cancellable once processing has started. To request a cancellation, please email us at enquiries@bioplexpeptides.co.uk with your order number and reason for cancellation.

Damaged or Incorrect Items

In the rare event that you receive a damaged or incorrect item, please notify us within 48 hours of receipt. Include your order number, photos of the product and packaging, and a description of the issue. We will assess the claim and, if validated, arrange for a replacement to be shipped promptly.

 

Read More on Our Returns & Refunds Policy

 

0
Shopping Basket
X