Fast Worldwide Shipping With Tracked 48 hour DHL Express Delivery
10 x LL-37 100mg
£328.99
25% Discount!!
LL-37 is a cationic, amphipathic peptide derived from the human cathelicidin antimicrobial protein hCAP-18. It is the only cathelicidin identified in humans and is composed of 37 amino acids. LL-37 adopts an alpha-helical structure and is studied extensively in immunology, molecular biology, and host defense peptide research
High-purity LL-37 peptide supplied in a 3ml sterile lyophilized vial
Specifications:
- Contents: 10 x 10mg LL-37
- Form: Lyophilized powder
- Purity: >99% (HPLC Verified)
- Storage: Store between 2°C and 8°C
- Molecular Formula: C₂₁₅H₃₄₄N₆₀O₅₀
- Sequence: [LL-37, 37 aa]
- Peptide Length: 37 Amino-Acids
- pH Range: 5.5-7.4
- Storage: Store between 2°C and 8°C
Note: Reconstitute with Bacteriostatic (BAC) water before use
LL-37 Peptide – Premium Grade (UK Supply)
Our LL-37 peptide is offered in the UK with verified purity exceeding 99%, manufactured under stringent conditions in ISO 9001 and GMP-certified laboratories. Intended exclusively for in-vitro research, this compound adheres to rigorous analytical and production standards to ensure consistency and reliability across experimental protocols
Supplied as a lyophilized powder, LL-37 maintains optimal molecular stability, facilitating precise handling and long-term preservation. To safeguard against degradation, oxidation, or contamination, researchers are advised to follow our comprehensive reconstitution and storage guidelines, available on our website
Each batch is synthesized through a controlled, high-fidelity process, ensuring structural integrity and reproducibility for scientific applications. Vials are prepared for reconstitution as required, supporting flexible use in laboratory settings
*For research purposes only, not for human consumption
LL-37 is a cationic, amphipathic peptide derived from the human cathelicidin antimicrobial protein hCAP-18. It is the only cathelicidin identified in humans and is composed of 37 amino acids. LL-37 adopts an alpha-helical structure and is studied extensively in immunology, molecular biology, and host defense peptide research
High-purity LL-37 peptide supplied in a 3ml sterile lyophilized vial
Specifications:
- Contents: 10 x 10mg LL-37
- Form: Lyophilized powder
- Purity: >99% (HPLC Verified)
- Storage: Store between 2°C and 8°C
- Molecular Formula: C₂₁₅H₃₄₄N₆₀O₅₀
- Sequence: [LL-37, 37 aa]
- Peptide Length: 37 Amino-Acids
- pH Range: 5.5-7.4
- Storage: Store between 2°C and 8°C
Note: Reconstitute with Bacteriostatic (BAC) water before use
LL-37 Peptide – Premium Grade (UK Supply)
Our LL-37 peptide is offered in the UK with verified purity exceeding 99%, manufactured under stringent conditions in ISO 9001 and GMP-certified laboratories. Intended exclusively for in-vitro research, this compound adheres to rigorous analytical and production standards to ensure consistency and reliability across experimental protocols
Supplied as a lyophilized powder, LL-37 maintains optimal molecular stability, facilitating precise handling and long-term preservation. To safeguard against degradation, oxidation, or contamination, researchers are advised to follow our comprehensive reconstitution and storage guidelines, available on our website
Each batch is synthesized through a controlled, high-fidelity process, ensuring structural integrity and reproducibility for scientific applications. Vials are prepared for reconstitution as required, supporting flexible use in laboratory settings
*For research purposes only, not for human consumption
You may also like
Shipping & Postage
We utilise couriers such as Fedex or DHL depending on the delivery location.
Allow 8-10 business days after dispatch conformation for all wholesale orders.
Ordering Process
All orders are typical processed within 24hrs after payment.
Depending on current stock levels larger wholesale orders are delivered direct from the manufacturer and synthesised to order offering batch level consistency, reduced degradation risk, and reliable performance.
Returns & Refunds
All orders maybe cancelled within 24hrs. Due to the nature of our products we do not offer refunds on all orders that have already been processed and shipped.
Ask a Question
If you have any questions regarding our research peptides for sale, please feel free to reach out below.
Quick Links
Policies
